A2FVZ8_TRIVA

Gene name A2FVZ8

Accession number A2FVZ8

Description Thioredoxin family protein

Links Uniprot

Organism Trichomonas vaginalis

Length 112

>tr|A2FVZ8|A2FVZ8_TRIVA Thioredoxin family protein OS=Trichomonas vaginalis OX=5722 GN=TVAG_232840 PE=4 SV=1
MSDPIVHFQGSNQDLLSRIKEASGLVVVDFFATWCPPCQYLGKILPSISQDNKDVTFIKVDIDQNDDATTAFNVSSIPSLFIMKKDGDEITTLDHFVGADVARIMLDISKFK
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy