B6A9E3_CRYMR

Gene name B6A9E3

Accession number B6A9E3

Description Cofilin / actin-depolymerizing factor 1 protein, putative

Links Uniprot

Organism Cryptosporidium muris (strain RN66)

Length 134

>tr|B6A9E3|B6A9E3_CRYMR Cofilin / actin-depolymerizing factor 1 protein, putative OS=Cryptosporidium muris (strain RN66) OX=441375 GN=CMU_039010 PE=3 SV=1
MSSGVIVDPSCLEAFQMQKIRKKHRYILYNLSEDYQNVVLYKSSSPEATYEEFLADIPDSECMYATVDLPGPKGQSSKLIFIMYTPQAASVKDRMVFASSKDGFVKKLEGVHGKLLQASEKSDLSFDSLVREYF
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy