D8RE92_SELML

Gene name D8RE92

Accession number D8RE92

Description Uncharacterized protein

Links Uniprot

Organism Selaginella moellendorffii

Length 122

>tr|D8RE92|D8RE92_SELML Uncharacterized protein OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_92031 PE=3 SV=1
MASTSVDVKELPASYVFVADVPGIKNSEVKVQIENDSILKISGERRRDDNPTFDVKYVRAERPAGKFMRKFNLPSNANLEGVSAACQDGQLTVVVPKIPPPAPYKPRTFDIPIGTLVYTNPK
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy