CAPSL_HUMAN

Gene Name CAPSL

Description Calcyphosin-like protein

Links Uniprot

Organism Homo sapiens

Loading...
MAGTARHDREMAIQAKKKLTTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAWKL
Loading...
Identifier
Description
Distance between phylogenetic profiles
Bardet-Biedl syndrome 7 protein
0.383
Protein PTHB1
0.383
Bardet-Biedl syndrome 2 protein
0.386
Identifier
Description
Distance between phylogenetic profiles
Tetratricopeptide repeat protein 8
0.381
Protein PTHB1
0.383
Bardet-Biedl syndrome 7 protein
0.383
Bardet-Biedl syndrome 2 protein
0.386
Relationship type Query & inparalogs Orthologs Orthologs description Orthologs length Species Taxonomy Taxid Whole Taxonomy
OrthoInspector website
Complex Systems and Translational Bioinformatics team - ICube laboratory
Web development by Yannis Nevers (yannis.nevers@icube.unistra.fr)