A0A2K8L5Q6_9PROT

Gene name A0A2K8L5Q6

Accession number A0A2K8L5Q6

Description tRNA threonylcarbamoyl adenosine modification protein, Sua5/YciO/YrdC/YwlC family

Links Uniprot

Organism Mariprofundus ferrinatatus

Length 205

>tr|A0A2K8L5Q6|A0A2K8L5Q6_9PROT tRNA threonylcarbamoyl adenosine modification protein, Sua5/YciO/YrdC/YwlC family OS=Mariprofundus ferrinatatus OX=1921087 GN=Ga0123462_1583 PE=3 SV=11
MHLFEHLRLHPERPQIRQIRRAVELLRQGLFVAVPTETTYVLLCLPESGKAVANITRLRQLDSSHMWSVVCADLSQAATCVRMDNHAHRILKRCLPGPYTFILPASSSLPKRIFGKRRDVGIRIPAHPVCQMLLDEIGEVLLATTLQLPGSAEPEYDPDEFVLRIKHLSCAIMDAGWCGMVPTTVVDLCGDEPELHRQGAGEWPA
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy