A0A058Z5P0_FONAL

Gene name A0A058Z5P0

Accession number A0A058Z5P0

Description Uncharacterized protein

Links Uniprot

Organism Fonticula alba

Length 121

>tr|A0A058Z5P0|A0A058Z5P0_FONAL Uncharacterized protein OS=Fonticula alba OX=691883 GN=H696_03987 PE=4 SV=1
MSSLQSRQARQNNRILFVKYLPFDVSSKTLYDLFGKFGAIQQIRLGNSPTTRGNAFVVYEIPDDANRAMAKLNGYQLSHRSITVLPFVPSRVYKKADLDARRARLDAVAESHGVQTDDLEA
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy