A0A059J073_TRIIM

Gene name A0A059J073

Accession number A0A059J073

Description NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondrial

Links Uniprot

Organism Trichophyton interdigitale (strain MR816)

Length 174

>tr|A0A059J073|A0A059J073_TRIIM NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondrial OS=Trichophyton interdigitale (strain MR816) OX=1215338 GN=H109_06830 PE=3 SV=1
MTFLRDHTAAEYTQVSDITAVDFPTREYRFEVVYNLLSVRHNSRIRVKTYADEATPVPSITSLYDGALWFEREVYDMFGVFFTGHPDLRRIMTDYGFDGHPLRKDFPLSGYTEIRYDEEKKRIVVEPLELTQAFRNFEGGSSAWEGIGQGVDRKPDNFKLPTPKPEEKPEEQKK
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy