A0A075AW70_ROZAC

Gene name A0A075AW70

Accession number A0A075AW70

Description 60S ribosomal protein L11

Links Uniprot

Organism Rozella allomycis (strain CSF55)

Length 182

>tr|A0A075AW70|A0A075AW70_ROZAC 60S ribosomal protein L11 OS=Rozella allomycis (strain CSF55) OX=988480 GN=O9G_002073 PE=3 SV=1
MLFYFLKAEESAKKNVMRDIYIWKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKAAITIRQFGVRRNEKIAVHCTVRGPKAKEILERGLKVKEYELKSENFSNTGNFGFGIQEHIDLGIKYDPNIGIYGMDFYVVLSRPGFRVARRKHCRAKVGRPHKLTKQDAIEWYKKTFDGIVSGK
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy