A0A087SEX5_AUXPR

Gene name A0A087SEX5

Accession number A0A087SEX5

Description Autophagy-related protein

Links Uniprot

Organism Auxenochlorella protothecoides

Length 87

>tr|A0A087SEX5|A0A087SEX5_AUXPR Autophagy-related protein OS=Auxenochlorella protothecoides OX=3075 GN=F751_5121 PE=3 SV=1
MVRTKTFKEEHPLEKRQAEATRIREKYPDRIPVIVEKAEKSDIPDIDKKKYLVPADLTVGQFVYVIRKRIKVSPEKAIFIGESTFGC
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy