A0A087SQ72_AUXPR

Gene name A0A087SQ72

Accession number A0A087SQ72

Description Trafficking protein particle complex subunit

Links Uniprot

Organism Auxenochlorella protothecoides

Length 171

>tr|A0A087SQ72|A0A087SQ72_AUXPR Trafficking protein particle complex subunit OS=Auxenochlorella protothecoides OX=3075 GN=F751_5441 PE=3 SV=1
METINAEILTLTYGSIVRQLISDYEDVDEVNKQLEKMGYNIGQRLIDEYLARSKTTSCSDFKEVAERIAHVGFRMFLNTSARVAAWAPDGRSCSLILEDNPLTDFVELPEQLRGLSYSNILCGVIRGALEMVNIDAECSFVRDSLRGDDATELRLTFVAAAPEAYPYKDDD
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy