A0A0B7F6Y5_THACB

Gene name A0A0B7F6Y5

Accession number A0A0B7F6Y5

Description ER lumen protein retaining receptor

Links Uniprot

Organism Thanatephorus cucumeris (strain AG1-IB / isolate 7/3/14)

Length 213

>tr|A0A0B7F6Y5|A0A0B7F6Y5_THACB ER lumen protein retaining receptor OS=Thanatephorus cucumeris (strain AG1-IB / isolate 7/3/14) OX=1108050 GN=RSOLAG1IB_05854 PE=4 SV=1
MNIFRLLGDMSHLASILILLHKIQTTRTSRGISFKTQALYVTVFLTRYIDLFMFQFVSLYNTFMKIFFIASSVYILYLMKFQYRSTTDPSIDTFKVEYLLGPSAVLALIFNYEFKFSEILWAFSIYLEAVAIFPQLFMLQRTGEAETITTHYIAALGAYRALYVPNWIYRYWTEGTVDPIAVIAGLVQTGLYIDFFYVYFTRVMQGEKFELPA
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy