A0A0D1C151_USTMA

Gene name A0A0D1C151

Accession number A0A0D1C151

Description Ribosomal 40S subunit protein S19

Links Uniprot

Organism Ustilago maydis (strain 521 / FGSC 9021)

Length 159

>tr|A0A0D1C151|A0A0D1C151_USTMA Ribosomal 40S subunit protein S19 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=UMAG_11551 PE=4 SV=1
MPNVRDVDASTFIDAYAQHLKRSGKIEVPTWVDIVKTGHFKEQAPYNPDWFYVRAAALARHIYLRKAVGIGHLRKFHGGASNRGFRPSHHADASGSVQRKVVQGLEGIGVLEKDPKGGRRISQDGMRDLDRIAVACLEAAAEEEEDESEEEDDEEEDDE
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy