A0A0J9XBE1_GEOCN

Gene name A0A0J9XBE1

Accession number A0A0J9XBE1

Description Similar to Saccharomyces cerevisiae YEL003W GIM4 Subunit of the heterohexameric cochaperone prefoldin complex which binds specifically to cytosolic chaperonin and transfers target proteins to it

Links Uniprot

Organism Geotrichum candidum

Length 124

>tr|A0A0J9XBE1|A0A0J9XBE1_GEOCN Similar to Saccharomyces cerevisiae YEL003W GIM4 Subunit of the heterohexameric cochaperone prefoldin complex which binds specifically to cytosolic chaperonin and transfers target proteins to it OS=Geotrichum candidum OX=1173061 GN=BN980_GECA08s00395g PE=4 SV=1
MSTTAAAPSTPARPPNAELQQQYNTFKSTLTQLSTKIAELESELDEHKLVVDTLKETPADRKCFRMIGGVLVEKSVKEVLPALQTNSQGLTQVIDTLRADMKRTETELRKWQKQYNVQIVQSNQ
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy