A0A0L0CH34_LUCCU

Gene name A0A0L0CH34

Accession number A0A0L0CH34

Description Uncharacterized protein (Fragment)

Links Uniprot

Organism Lucilia cuprina

Length 86

>tr|A0A0L0CH34|A0A0L0CH34_LUCCU Uncharacterized protein (Fragment) OS=Lucilia cuprina OX=7375 GN=FF38_03482 PE=4 SV=1
MASLTPLEATDLLEFNAINLDVLTENYDLEYYLLYFCKWPSLNFKVEDTNKHPIGYMLGKSEGLGFDWHSHISAVTVEKDYRRLGL
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy