A0A165T2J2_9AGAM

Gene name A0A165T2J2

Accession number A0A165T2J2

Description Ribosomal protein 60S

Links Uniprot

Organism Neolentinus lepideus HHB14362 ss-1

Length 98

>tr|A0A165T2J2|A0A165T2J2_9AGAM Ribosomal protein 60S OS=Neolentinus lepideus HHB14362 ss-1 OX=1314782 GN=NEOLEDRAFT_1132542 PE=3 SV=1
MPISPKHTQSDKIIALTSAADVELEPIWATLLARALEGKNVKDILSNVGAGGAGPAVGAAPAAGAAAAGGAAAAEEKAEEKEEEKEESDDDMGFGLFD
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy