A0A1S2XW64_CICAR

Gene name A0A1S2XW64

Accession number A0A1S2XW64

Description 60S acidic ribosomal protein P1-3-like

Links Uniprot

Organism Cicer arietinum

Length 112

>tr|A0A1S2XW64|A0A1S2XW64_CICAR 60S acidic ribosomal protein P1-3-like OS=Cicer arietinum OX=3827 GN=LOC101496948 PE=3 SV=1
MSIGETACSYALLILEDDKIPATADNITTLLKSAKVEVESFWPSLFAKLAEKKNIRDLISSAAGGGAPVTVAAAPVAAAGGAAAAAAPAAEEKKKEEPAEESDDDMGFSLFD
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy