A0A1S2Z8G7_CICAR

Gene name A0A1S2Z8G7

Accession number A0A1S2Z8G7

Description 60S acidic ribosomal protein P1-like

Links Uniprot

Organism Cicer arietinum

Length 75

>tr|A0A1S2Z8G7|A0A1S2Z8G7_CICAR 60S acidic ribosomal protein P1-like OS=Cicer arietinum OX=3827 GN=LOC101515430 PE=4 SV=1
MSAGELACIYSILMLHNDGIAITAEKINTILKAVGVTVESYWPSLFAKLAQNKSIDDLVLNAGATGGAAVAVSAP
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy