A0A1S3B5N7_CUCME

Gene name A0A1S3B5N7

Accession number A0A1S3B5N7

Description mitochondrial inner membrane protease subunit 2

Links Uniprot

Organism Cucumis melo

Length 184

>tr|A0A1S3B5N7|A0A1S3B5N7_CUCME mitochondrial inner membrane protease subunit 2 OS=Cucumis melo OX=3656 GN=LOC103486302 PE=4 SV=1
MANRNLVWNVVKKSFTFGIIGVTISDRYASVVPIRGASMSPTFNPIATSLTGPMTGDYVLVEKFCLEKYKFSPGDVIVYRSPCNYKEKQVKRIIALPGDWVGTRQTYDVVKVPEGHCWVEGDNPECSMDSRSFGPIPMGLIQGRVSHIVWPPQRIGAVEKKYPQGESNPTNSTKTQGRERTSFS
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy