A0A2I1BW01_9EURO

Gene name A0A2I1BW01

Accession number A0A2I1BW01

Description Putative prefoldin subunit 2

Links Uniprot

Organism Aspergillus novofumigatus IBT 16806

Length 118

>tr|A0A2I1BW01|A0A2I1BW01_9EURO Putative prefoldin subunit 2 OS=Aspergillus novofumigatus IBT 16806 OX=1392255 GN=P174DRAFT_464005 PE=4 SV=1
MASQAQINPKKQQELQLQYTNFKNTLTQMAQKIGDIEQEAEEHKLVIETLEPLPQDRKCFRMVNGVLVERTVKDVLPALKTNSDGLKQVLDELVKQYQSKQSELDDWKKKNNIQVVQP
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy