A0A2I1CAI2_9EURO

Gene name A0A2I1CAI2

Accession number A0A2I1CAI2

Description DNA-directed RNA polymerase subunit

Links Uniprot

Organism Aspergillus novofumigatus IBT 16806

Length 116

>tr|A0A2I1CAI2|A0A2I1CAI2_9EURO DNA-directed RNA polymerase subunit OS=Aspergillus novofumigatus IBT 16806 OX=1392255 GN=P174DRAFT_421171 PE=3 SV=1
MLTFCPNCGNSLTISRGEPTREYPLGVNRFECRTCPYQHLLKHGRQEKTTMKQKEVEDVFGGKEEFANADSMATQCPAEDCNGDRAYFFQLQIRSADEPMTTFLKCTTCGARWREN
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy