A0A2I2FJR2_9EURO

Gene name A0A2I2FJR2

Accession number A0A2I2FJR2

Description Integral membrane protein S linking to the trans Golgi network-domain-containing protein

Links Uniprot

Organism Aspergillus candidus

Length 208

>tr|A0A2I2FJR2|A0A2I2FJR2_9EURO Integral membrane protein S linking to the trans Golgi network-domain-containing protein OS=Aspergillus candidus OX=41067 GN=BDW47DRAFT_83112 PE=4 SV=1
MPVRRRRAAGGARSELPPLKIVRKILLLQLAYYASATVLILFTTLVYGTPFSLDLVLNWDAIRGDTTIGWMLGFVWVLNSGLGVIFLLLLVVRSKLIPDFALTIHFLHIIATTLYTHSIPRNWLWWGLQGASAALMTFLGVWACQWRELQPISFGGIGGSSSGSGSGPSSQPAGDDNGESSRGRGRARDLGGNEYEMGEIKVTGDQAV
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy