A0A2Y9FWR1_PHYMC

Gene name A0A2Y9FWR1

Accession number A0A2Y9FWR1

Description peroxisomal 2,4-dienoyl-CoA reductase isoform X1

Links Uniprot

Organism Physeter macrocephalus

Length 292

>tr|A0A2Y9FWR1|A0A2Y9FWR1_PHYMC peroxisomal 2,4-dienoyl-CoA reductase isoform X1 OS=Physeter macrocephalus OX=9755 GN=DECR2 PE=4 SV=1
MAQPPPDVREDDCLPEYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVSMAARKLAAATGQRCLPLSLDVRAPLAIMAAVEQALKEFGKIDILINCAAGNFLCPASALSSNAFKTVMDIDTLGTFNVSRVLYEKFFHDHGGVIVNITATLGTRGQVLQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGFRRLGGPQASMRAKVLASPLQRLGNKTEIAHSALFLASPLASYVTGALLVVDGGAWLTFPNDIQSLADFSSFSAKL
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy