A0A317XBZ9_9EURO

Gene name A0A317XBZ9

Accession number A0A317XBZ9

Description Orm1 type endoplasmic reticulum protein

Links Uniprot

Organism Aspergillus sclerotioniger CBS 115572

Length 179

>tr|A0A317XBZ9|A0A317XBZ9_9EURO Orm1 type endoplasmic reticulum protein OS=Aspergillus sclerotioniger CBS 115572 OX=1450535 GN=BO94DRAFT_542473 PE=4 SV=1
MAQGKAGRRRRSSSIIYQEPAESIEHTSDQAALPNLNANWVNAKGAWTIHFVLIVCLKIFYDIIPGVSQETSWTLTNISYMFGSFLMFHWVRGIPFEFNAGAYDNLNMWEQIDNGDQYTPTKKFLLCVPICLFLLSTHYTHYDLTYFTINFLATLGVVIPKLPFSHRLRIGLFSDIPEE
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy