A0A329T2F3_9STRA

Gene name A0A329T2F3

Accession number A0A329T2F3

Description Uncharacterized protein

Links Uniprot

Organism Phytophthora cactorum

Length 189

>tr|A0A329T2F3|A0A329T2F3_9STRA Uncharacterized protein OS=Phytophthora cactorum OX=29920 GN=PC110_g1000 PE=4 SV=1
MVSIRNATADDLLQVQNSNLWCLPENYQMKYYYYHIMTWPQLLYVAEERGGKIVGYVLAKMEEEASVPHGHITSLAVLRTHRKCGLATKLMLAAQRAMVESFGAEYVSLHVREGNVAAIHLYRKTLKYQVYDIEKGYYADGEDAYDMRMPFTDKCNQAFSSQVNRFKKVLAEKDAEKAAKDAKEKEASA
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy