A0A369HE21_9HYPO

Gene name A0A369HE21

Accession number A0A369HE21

Description Cytochrome c oxidase subunit

Links Uniprot

Organism Ophiocordyceps sp. camponoti-saundersi

Length 88

>tr|A0A369HE21|A0A369HE21_9HYPO Cytochrome c oxidase subunit OS=Ophiocordyceps sp. 'camponoti-saundersi' OX=2039874 GN=CP533_0613 PE=3 SV=1
MSDDDGSELVTKPFKFVTGTDARFPNMNQTKHCWQNYVDYHKCIIAKGEDFKPCHQFWLAYRSMCPSSWYERWDAQREGGNFPVKLDS
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy