A0A370TYT5_9PEZI

Gene name A0A370TYT5

Accession number A0A370TYT5

Description Epsilon subunit of F1F0-ATP synthase N-terminal

Links Uniprot

Organism Phialophora cf. hyalina BP 5553

Length 166

>tr|A0A370TYT5|A0A370TYT5_9PEZI Epsilon subunit of F1F0-ATP synthase N-terminal OS=Phialophora cf. hyalina BP 5553 OX=2005443 GN=BP5553_00649 PE=3 SV=1
MNSLRIARTVLRARPAAIKAPLLQRRGYAEAVSDKIKLSLVLPHQSIYKSQDVVQVNIPAESGDMGVLANHVPSIEQLKPGLVEIIEETAGSKQYFLSGGFAIVQPNSELSINAVEGFPLEDFSIDAVRSQISEAQKIAGGSGSEQDIAEAKIELEVLEGLQAVLK
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy