A0A395GZ23_9EURO

Gene name A0A395GZ23

Accession number A0A395GZ23

Description Ribosomal protein L34 protein

Links Uniprot

Organism Aspergillus ibericus CBS 121593

Length 117

>tr|A0A395GZ23|A0A395GZ23_9EURO Ribosomal protein L34 protein OS=Aspergillus ibericus CBS 121593 OX=1448316 GN=BO80DRAFT_356531 PE=4 SV=1
MANNRLQYRRRNPYNTRSNQVRIIKTPGGELRYLHIKKKGTAPKCGDCGIKLPGVPALRPREYAQISRPKKNVSRAYGGSRCAGCVKDRIVRAFLIEEQKIVKKVLKESQEKAAGKR
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy