A0A395HB89_9EURO

Gene name A0A395HB89

Accession number A0A395HB89

Description Ribosomal protein L37ae

Links Uniprot

Organism Aspergillus ibericus CBS 121593

Length 92

>tr|A0A395HB89|A0A395HB89_9EURO Ribosomal protein L37ae OS=Aspergillus ibericus CBS 121593 OX=1448316 GN=BO80DRAFT_442197 PE=3 SV=1
MTKRTKKVGITGKYGTRYGASLRKQVKKMEVSQHARYICTFCGKNTVKRKAVGIWECKGCNKVVAGGAYTVSTPAAAATRSTIRRLREIAEV
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy