A2Q8T6_ASPNC

Gene name A2Q8T6

Accession number A2Q8T6

Description Arp2/3 complex 34 kDa subunit

Links Uniprot

Organism Aspergillus niger (strain CBS 513.88 / FGSC A1513)

Length 320

>tr|A2Q8T6|A2Q8T6_ASPNC Arp2/3 complex 34 kDa subunit OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An01g05510 PE=3 SV=1
MLLLDYHNVLIHSLLTERFSGTPPVSIDQIVSDFDGVTFHLSTPESKTKILISINVKCFRELVQYGAQEVLEREYGPYIVTPEPGYDFSVLIDLENLPAEQEAKDELIMRLALMKRNAMAAPFERAFDEFAKLAEEASRYTSETAPQGVKEGGEVMAIHYREEEAIYIKASHDRVTVIFSTVFREETDRIFGKVFLQEFVDARRRVLTLQNAPQVLFRNDCPLELAGVPGLQNGNDGRISYVTFVLFPRHLTPQRRYENISHIQIFRDYFHYHIKASKAYIHTRMRKRTADFLQVLNRARPENEERERKTASGRTFRVQG
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy