A2QHV7_ASPNC

Gene name A2QHV7

Accession number A2QHV7

Description Cytochrome b-c1 complex subunit 7

Links Uniprot

Organism Aspergillus niger (strain CBS 513.88 / FGSC A1513)

Length 122

>tr|A2QHV7|A2QHV7_ASPNC Cytochrome b-c1 complex subunit 7 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An04g01200 PE=3 SV=1
MSAPSLASYIVKRPFLKRWMMPIAQWYTDASGYRRLGLKADDLIPEENDVVQKALKRLPPKEAYDRIFRIRRAFQCSISHTLLPAAEQTKPEEDVEYLSPIIREIEKEKQEREDLDALVVRR
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy