A2RB80_ASPNC

Gene name A2RB80

Accession number A2RB80

Description 40S ribosomal protein S26

Links Uniprot

Organism Aspergillus niger (strain CBS 513.88 / FGSC A1513)

Length 119

>tr|A2RB80|A2RB80_ASPNC 40S ribosomal protein S26 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An18g05810 PE=3 SV=1
MVKKRANNGRNKNGRGHVKPVRCSNCARCTPKDKAIKRFTIRNMVESAAIRDISDASVFTDYAVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRIRYNKDGKKLNPPQAAKAM
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy