A4S909_OSTLU

Gene name A4S909

Accession number A4S909

Description 22-kDa heat-shock protein

Links Uniprot

Organism Ostreococcus lucimarinus (strain CCE9901)

Length 138

>tr|A4S909|A4S909_OSTLU 22-kDa heat-shock protein OS=Ostreococcus lucimarinus (strain CCE9901) OX=436017 GN=HSP22a PE=3 SV=1
MGNPWMPLAQRTPGASGALAPLAGGLRVIPVDVLEDEKSYVLRADLPGMKKEDVNVEVDGQIVRISATKKDTKKWEDEGYKYHRAERRDTMEYSQRALRMPQNTDFSKLDAAFDDGTLTVTFGKQATSTPTAKQISIK
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy