B0WQU6_CULQU

Gene name B0WQU6

Accession number B0WQU6

Description Ribosomal protein L37

Links Uniprot

Organism Culex quinquefasciatus

Length 91

>tr|B0WQU6|B0WQU6_CULQU Ribosomal protein L37 OS=Culex quinquefasciatus OX=7176 GN=6041884 PE=3 SV=1
MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKHTCSQCGYPSAKIRTYNWSIKAKRRKTTGTGRMRYLKIVRRKFRNGFREGQVAKPRKAAA
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy