B0XF39_CULQU

Gene name B0XF39

Accession number B0XF39

Description Mitochondrial inner membrane protein translocase, 8kD-subunit, putative

Links Uniprot

Organism Culex quinquefasciatus

Length 89

>tr|B0XF39|B0XF39_CULQU Mitochondrial inner membrane protein translocase, 8kD-subunit, putative OS=Culex quinquefasciatus OX=7176 GN=6051903 PE=3 SV=1
MADFDAASAGKNVDPELQDFLMAEKQKAQLSAQIHEFNDICWEKCMDKPSNKLDSRTETCLNNCVNRFIDTSLFTATRFAQTLQNAQGM
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy