B6ADG2_CRYMR

Gene name B6ADG2

Accession number B6ADG2

Description Nascent polypeptide-associated complex subunit beta

Links Uniprot

Organism Cryptosporidium muris (strain RN66)

Length 162

>tr|B6ADG2|B6ADG2_CRYMR Nascent polypeptide-associated complex subunit beta OS=Cryptosporidium muris (strain RN66) OX=441375 GN=CMU_007430 PE=3 SV=1
MSGLNLNEDAIEVARQKLRERFGAATQVGGKGTARRKKRTQKPAGGMDLKKLQTITNRFRCQTFPAIGDITMMRSDGTCLHFINPKLQASVTSNTYIISGNGQERKIKDLPRQVNQMDLSAFLNDPKFRRLFQDSQSGNAPNLQSNEEDDIPDLVENFEEIE
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy