B6AIA4_CRYMR

Gene name B6AIA4

Accession number B6AIA4

Description Splicing factor 3A subunit 2, putative (Fragment)

Links Uniprot

Organism Cryptosporidium muris (strain RN66)

Length 105

>tr|B6AIA4|B6AIA4_CRYMR Splicing factor 3A subunit 2, putative (Fragment) OS=Cryptosporidium muris (strain RN66) OX=441375 GN=CMU_030860 PE=4 SV=1
MDHQHRGGHKTGSGALASSQDIAIERRERLRRLALETIDLSKDPYFMKNHLGQIECRLCLTIHTNEASYLSHTQARRHQTNLIYRAAKEKSGKLSKLTSDQIDLS
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy