D4A9N8_RAT

Gene name D4A9N8

Accession number D4A9N8

Description MPV17 mitochondrial inner membrane protein-like 2

Links Uniprot

Organism Rattus norvegicus

Length 164

>tr|D4A9N8|D4A9N8_RAT MPV17 mitochondrial inner membrane protein-like 2 OS=Rattus norvegicus OX=10116 GN=Mpv17l2 PE=3 SV=2
MATGDGARQAWEVRARPEQRFSARRSASMFAVGCSMGPFLHFWYLWLDRLLPASGLRSLPSVMKKVLVDQTVASPILGVWYFLGLGSLEGQTLEESCQELRAKFWDFYKADWCVWPAAQLVNFLFIPSHFRVTYINGLTLGWDTYLSYLKYWAPEPLQTPGCAD
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy