F4PGY2_CAVFA

Gene name F4PGY2

Accession number F4PGY2

Description Heat shock protein Hsp20 domain-containing protein

Links Uniprot

Organism Cavenderia fasciculata (strain SH3)

Length 142

>tr|F4PGY2|F4PGY2_CAVFA Heat shock protein Hsp20 domain-containing protein OS=Cavenderia fasciculata (strain SH3) OX=1054147 GN=hspI PE=3 SV=1
MSLQMWNNPWSELDKSMENMTQTMEPFNKNSYGGLWKPSCDVTETPDNLMISCELPGCNKDGINLDISDGRLTISGERSYEKKVDNEKYHRIERSYGKFQRSFSIPEGCTEKDVEATFENGILQVNLKKCAKTETPKRIFIK
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy