G0R7Q5_HYPJQ

Gene name G0R7Q5

Accession number G0R7Q5

Description Ribosomal protein

Links Uniprot

Organism Hypocrea jecorina (strain QM6a)

Length 217

>tr|G0R7Q5|G0R7Q5_HYPJQ Ribosomal protein OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=rpl1 PE=3 SV=1
MSKITVANVRTQVAELLEYSNETKKRNFLETVELQIGLKNYDPQRDKRFSGTIKLPSVPRPNMSICILGDQHDLDRAKHGGVDAMSVDDLKKLNKNKKLIKKLARKYDAFIASETLIKQIPRLLGPGLSKAGKFPTPVSHADDLSGKINEVKSTIKFQLKKVLCMGVAVGNVGMEQEQLIGNIMLAINYLVSLLKKGWQNVGSLTIKASMSPPKRLY
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy