G0RDD8_HYPJQ

Gene name G0RDD8

Accession number G0RDD8

Description Predicted protein (Fragment)

Links Uniprot

Organism Hypocrea jecorina (strain QM6a)

Length 130

>tr|G0RDD8|G0RDD8_HYPJQ Predicted protein (Fragment) OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=TRIREDRAFT_33728 PE=4 SV=1
VNLDTLEPQQLAQVKKQLEEELEHLTSSFAQLHGAQNKFKECLRCVQARAADSKGSKSVLVPLTNSLYVSGELTSTETVLVDVGTGFMIEKKLKSAEKFYDSKVKEVGGNLKELEVIVQRKQMNVRTIEE
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy