G0RDP8_HYPJQ

Gene name G0RDP8

Accession number G0RDP8

Description Uncharacterized protein

Links Uniprot

Organism Hypocrea jecorina (strain QM6a)

Length 109

>tr|G0RDP8|G0RDP8_HYPJQ Uncharacterized protein OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=TRIREDRAFT_120621 PE=3 SV=1
MPSESGHRLYVKGRHLSYQRSRHITHPGTSLIKIEGVDSTAAANFYLGKKVAFVYRGQKEIRGTKIRVIWGKVTRPHGNSGVVRAKFAKPLPSKSFGASVRVMLYPSSI
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy