G0RG87_HYPJQ

Gene name G0RG87

Accession number G0RG87

Description Uncharacterized protein

Links Uniprot

Organism Hypocrea jecorina (strain QM6a)

Length 157

>tr|G0RG87|G0RG87_HYPJQ Uncharacterized protein OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=TRIREDRAFT_121219 PE=3 SV=1
MSKAKGAAAGVDTIVKLIVGAGQASPSPPVGPALGSKGVKSMDFCKEFNARTAHIVPGTPMPCRVTVRPDRSFTFDVRTPQTSWLLLNAVGAPVGKKGNRKGVSKPGHETVGTISLKHIYEIAKIKQSELRLSGLSLEGLCRSIIFQCKSIGINVVA
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy