G0RM12_HYPJQ

Gene name G0RM12

Accession number G0RM12

Description 40s ribosomal protein L44e

Links Uniprot

Organism Hypocrea jecorina (strain QM6a)

Length 106

>tr|G0RM12|G0RM12_HYPJQ 40s ribosomal protein L44e OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=rpl44 PE=3 SV=1
MVNIPKTRNTYCKGKECRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECVKCKTKLQLALKRCKHFELGGDKKTKGAALVF
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy