G0RMJ8_HYPJQ

Gene name G0RMJ8

Accession number G0RMJ8

Description Predicted protein

Links Uniprot

Organism Hypocrea jecorina (strain QM6a)

Length 157

>tr|G0RMJ8|G0RMJ8_HYPJQ Predicted protein OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=TRIREDRAFT_108519 PE=3 SV=1
MALCQNRLQEERKQWRRDHPFGFFAKPSRTKEGVLDLKNWECGIPGKEKTIWEGGLFKLNIAFPDEYPTKPPKCKFVPPLFHPNVYPSGTVCLSILNEEEAWKPAITVKQILLGIQDLLNDPNPESPAQADAYNLFKKDKIEYEKRIRRVVRENPAP
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy