G7PIL6_MACFA

Gene name G7PIL6

Accession number G7PIL6

Description U6 snRNA-associated Sm-like protein LSm3

Links Uniprot

Organism Macaca fascicularis

Length 102

>tr|G7PIL6|G7PIL6_MACFA U6 snRNA-associated Sm-like protein LSm3 OS=Macaca fascicularis OX=9541 GN=LSM3 PE=3 SV=1
MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy