G7PW18_MACFA

Gene name G7PW18

Accession number G7PW18

Description Uncharacterized protein (Fragment)

Links Uniprot

Organism Macaca fascicularis

Length 200

>tr|G7PW18|G7PW18_MACFA Uncharacterized protein (Fragment) OS=Macaca fascicularis OX=9541 GN=EGM_08411 PE=4 SV=1
RAGVQVLELDGGGHFLGRLAAIVAKQVLLGRKVVILPCEGINISGSFYRNTLKYLAFLRKRMNTTRPQALRLPAPSRIFRRTVRGKLRHKRGQAAVGLRRVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAYEVGWKYQAVTATLEEKRKEKAKIHYQRKKQLRRLRKQAEKNVEKKIDKYTQVLKTHGLLV
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy