G7PWW0_MACFA

Gene name G7PWW0

Accession number G7PWW0

Description Uncharacterized protein

Links Uniprot

Organism Macaca fascicularis

Length 105

>tr|G7PWW0|G7PWW0_MACFA Uncharacterized protein OS=Macaca fascicularis OX=9541 GN=EGM_08905 PE=3 SV=1
MGNVEKGKKIFTMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGITWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy