K7EA16_ORNAN

Gene name K7EA16

Accession number K7EA16

Description Uncharacterized protein

Links Uniprot

Organism Ornithorhynchus anatinus

Length 109

>tr|K7EA16|K7EA16_ORNAN Uncharacterized protein OS=Ornithorhynchus anatinus OX=9258 PE=4 SV=1
VVCHGLSSPLQNVKQLYALVCETQRYSAVLDSIIDSAGLLKAEKKLRPHLAKVLVYDLLLGRGLRGGGRWKPVLARHRARLQAELARLKVRRRVSRNEDLSGVRERSPP
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy