M5BM35_THACB

Gene name M5BM35

Accession number M5BM35

Description Negative cofactor 2 complex subunit beta

Links Uniprot

Organism Thanatephorus cucumeris (strain AG1-IB / isolate 7/3/14)

Length 142

>tr|M5BM35|M5BM35_THACB Negative cofactor 2 complex subunit beta OS=Thanatephorus cucumeris (strain AG1-IB / isolate 7/3/14) OX=1108050 GN=BN14_01326 PE=4 SV=1
MSDHEGPSSAADDELSLPKATVQKLIAEILPKDILSSKESRDLIIECCVEFIHMISTEANEICEKEAKKTISPEHIVGALKTLGFESYVEEVEGVLKDHKQAQKDREKKTSKFEASGKSEEQLLAEQQQLFEASRARFHAGQ
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy