M5BXB5_THACB

Gene name M5BXB5

Accession number M5BXB5

Description Transcription initiation factor IIA subunit 2

Links Uniprot

Organism Thanatephorus cucumeris (strain AG1-IB / isolate 7/3/14)

Length 114

>tr|M5BXB5|M5BXB5_THACB Transcription initiation factor IIA subunit 2 OS=Thanatephorus cucumeris (strain AG1-IB / isolate 7/3/14) OX=1108050 GN=BN14_06334 PE=3 SV=1
MASTYYEFYRGSSIGIALTDSLDELITSGSITPQLAMKVLAQFDKSLADTLVKHVKVKTNLKGHLSTYRLCDEVWTFIVRGANFKMESNEVVTAQKIKIVACKNGEAQDPGKKQ
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy